PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo16G0053100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 270aa    MW: 29495 Da    PI: 5.6394
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo16G0053100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv +++++G g+W++ ++  g+ R++k+c++rw +yl
  Spipo16G0053100 14 KGPWTAEEDQVLVSYIQRHGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.93.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  Spipo16G0053100  67 RGNFSKEEEDAIIHLHEILGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.754961IPR017930Myb domain
SuperFamilySSF466893.05E-3110108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002496.0E-161461IPR001005SANT/Myb domain
CDDcd001675.24E-111661No hitNo description
PROSITE profilePS5129424.12562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2565115IPR009057Homeodomain-like
SMARTSM007175.3E-1566114IPR001005SANT/Myb domain
PfamPF002496.2E-1567112IPR001005SANT/Myb domain
CDDcd001672.29E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTAE EDQVLVSYIQ RHGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SKEEEDAIIH LHEILGNRWS AIAARLPGRT DNEIKNVWHT HLKKRGKDSS  120
GPGSQKPTGE EARSESCSGG AASFAAEAET KHAVLRDLRS PPPSLQRSCS ELSSAATDSS  180
NAASVKEEHD GSLEEFPDMA EFLWWAAPMS SEIPLMAADN LSESGGSSLP SSVQRGEDLQ  240
ASASSGEDDM DLWLRVLMEV GDFPELPSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121155107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934323.18e-94PREDICTED: myb-related protein Myb4-like
RefseqXP_010920477.19e-94PREDICTED: myb-related protein Myb4
SwissprotQ7XBH41e-81MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLQ9SLT22e-92Q9SLT2_TOBAC; Myb-related transcription factor LBM1
STRINGSolyc09g090130.2.16e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-75myb domain protein 15